Protein Info for PGA1_c32140 in Phaeobacter inhibens DSM 17395

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 transmembrane" amino acids 43 to 69 (27 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 243 to 366 (124 residues), 73.8 bits, see alignment E=7e-25 PF13188: PAS_8" amino acids 244 to 296 (53 residues), 28.9 bits, see alignment 3.2e-10 PF00989: PAS" amino acids 245 to 356 (112 residues), 62 bits, see alignment E=2.1e-20 PF08448: PAS_4" amino acids 251 to 360 (110 residues), 40.7 bits, see alignment E=1e-13 PF13426: PAS_9" amino acids 254 to 358 (105 residues), 56.4 bits, see alignment E=1.3e-18 PF08447: PAS_3" amino acids 269 to 351 (83 residues), 36.3 bits, see alignment E=2.2e-12 PF00512: HisKA" amino acids 380 to 444 (65 residues), 81.8 bits, see alignment E=1.2e-26 PF02518: HATPase_c" amino acids 491 to 605 (115 residues), 104.8 bits, see alignment E=1.4e-33 PF00072: Response_reg" amino acids 631 to 741 (111 residues), 91.8 bits, see alignment E=1.3e-29

Best Hits

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUW7 at UniProt or InterPro

Protein Sequence (754 amino acids)

>PGA1_c32140 signal transduction histidine kinase (Phaeobacter inhibens DSM 17395)
MSQADALKNGPLETYNRRYSQRGLLNRYADGRRQYFVYRQMTMAGISALIGLLTFPLVGL
LVFLVAFLGDMLDTVYLARATPIGENGRFRQVQVISGITAAIQALSLAFLAWSPSVFMHS
ADHLHQAHATPLFTVGILIGAAINATVILPYNVPAGITRLAVYGLTPLVAITLESIIETG
GGMDEVQLFQIAGLGVLYFSVFFFVSFIVGRYNRSRKNTLAMALQHKQLAQINAKLQAQQ
LQSQRLALVAENANDSVFLMDEKGRISWVNEAFTRITGYRYDEAIGKMPGALLNGDDTDM
AVVRALEKGRATGKPFRLEICNRRKDGQLLWLETNQVPMLRDDGTVETIIAVERDVTAAK
QYEQQLKDARIAAEEGARVKSEFLATMSHEIRTPMNGVIGMAQMLERTQLDEEQKLYADT
ILGSARTLLSLINDVLDLSKMDAGEVILSEVDFDLPACFQQTLQLFEPQAQEKGITLDLN
IAPDVPRIINGDDRRLRQVLLNLVGNAVKFTDTGGVGVAVTTSRVGDRLRLRFSVTDTGI
GIAKEKQDQIFERFSQADAAITRRFGGTGLGLTISRLLCEAMGGEIDVTSDPGKGSCFSV
HLRMQPATGANLAEVAASAQQAGRSLEGMRILVAEDNRINRLLVEKYLQDEPVTLEFAVD
GAEALEKTPDFAPDVILMDMSMPVMNGLDATRNIREMDIRQPVIAALTANAFDSDREACL
KAGMDDFLSKPINRDDLLAVLRKHCPAEGRSAAV