Protein Info for Psest_3214 in Pseudomonas stutzeri RCH2

Annotation: phosphate acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 PF13500: AAA_26" amino acids 2 to 212 (211 residues), 96.4 bits, see alignment E=3.2e-31 PF07085: DRTGG" amino acids 217 to 326 (110 residues), 96.7 bits, see alignment E=1.1e-31 PF01515: PTA_PTB" amino acids 375 to 690 (316 residues), 408.1 bits, see alignment E=4.6e-126 TIGR00651: phosphate acetyltransferase" amino acids 390 to 690 (301 residues), 417.2 bits, see alignment E=2.2e-129

Best Hits

Swiss-Prot: 72% identical to PTA_PSEAE: Phosphate acetyltransferase (pta) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13788, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 98% identity to psa:PST_1126)

Predicted SEED Role

"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQX3 at UniProt or InterPro

Protein Sequence (698 amino acids)

>Psest_3214 phosphate acetyltransferase (Pseudomonas stutzeri RCH2)
MHTIFLAPTGFGGGLNSISLGLIRALENAGLKVGFFKPIAQPFPVDQGRERSCILVERTL
KLTSPEPLPLEQVERQLADGEIDLLLEDVVSRYQQVAAGKDVVIVEGMVPTRESNYTQRI
NTQLAKSLDAEVILIAAQGNDSLKRLAERIEIQAQLYGGAKDPKVLGVILNKVKTEEGLP
AFIDSLKQHLPLLGSADFQLLGAIPFSEELNALRTRDIAELLGAQVLNAGEADQRRVNKI
VLCARAVPNTVQLLQSGVLVVTPGDRDDIILAASLASLNGEKLAGLLLCSDFAPDPRILE
LCKAALDGGLPVMTVETNSYDTANNLFGLNKETPADDIERATRVTDFIAKHLHPEFLHTR
CSVPRGELRMSPAAFRYQLVKRAQDANKRIVLPEGNEPRTIRAAAICQERGIARCVLLAK
PEEVQQVAREQGISLPASLEILDPDSIANRYVEPMCEMRKAKGLTPEDAREQLKDTVVLG
TMMLALDEVDGLVSGAVHTTANTIRPALQLIKTAPGYSLVSSVFFMLLPDQVLVYGDCAV
NPNPSATELAEIALQSAESAVALGVNPRVAMISYSTGSSGSGAEVEKVAEATRIAQERAP
ALPIDGPLQYDAASVLSVGKQKAPNSKVAGQATVFIFPDLNTGNTTYKAVQRNANCLSVG
PMLQGLAKPVNDLSRGALVDDIVFTIALTALQAANQKG