Protein Info for PGA1_c32060 in Phaeobacter inhibens DSM 17395

Annotation: glutathione-binding protein GsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00496: SBP_bac_5" amino acids 69 to 397 (329 residues), 306.1 bits, see alignment E=2e-95

Best Hits

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 80% identity to sil:SPO0101)

Predicted SEED Role

"Peptide/opine/nickel uptake family ABC transporter, periplasmic substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERB3 at UniProt or InterPro

Protein Sequence (492 amino acids)

>PGA1_c32060 glutathione-binding protein GsiB (Phaeobacter inhibens DSM 17395)
MTRLPFLFAASSALAILAGAAAARDTVTVALQLEPPHLDPTSAAAGAIDQVLYSNVFEGL
TRFMGDGSVVPGLAQSWGISEDGLSYTFTLQDGVTFHDGTTMDAEDVKFSLDRARAEDST
NAQKALFADIASVDVVDPLTVKLTLSQPNGNLLFNLAWGDAVIVAPETIDTIKTAPVGTG
AFTFTNWVQGDRIDLARNPDYWGEAPALSAATFKFISDPTAAFAAMMAEDIDAFSAFPAP
ENLPQFEADPRFQVLIGSTEGETILSINNKQAPFDNPKVRAAVAHAIDRQAIIDGAMFGY
GTPIGSHFAPHNPAYIDLTGTSAHDPEKARALLAEAGLADGFTTTLHLPPPSYARRGGEI
IAAQLAEVGITAEIINVEWAQWLETVFRGKNFGLSIVSHTEPMDIGIYARPDYYFQYDNA
AFQDLMAELTGTTDPDARTKMLQQAQEIIANDYVNGYLFQLAALSVAKADLQGLWANAPT
QATDLTVVSWAK