Protein Info for PGA1_c32050 in Phaeobacter inhibens DSM 17395

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF02548: Pantoate_transf" amino acids 14 to 263 (250 residues), 359.7 bits, see alignment E=4.6e-112 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 16 to 268 (253 residues), 312.6 bits, see alignment E=1.2e-97

Best Hits

Swiss-Prot: 91% identical to PANB_RUEPO: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 91% identity to sil:SPO0102)

MetaCyc: 48% identical to 3-methyl-2-oxobutanoate hydroxymethyltransferase (Thermococcus kodakarensis)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0V4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PGA1_c32050 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB (Phaeobacter inhibens DSM 17395)
MSATARKMAPNAEDIRARKGGTPLVSLTAYTTPMAQFMDGHCDFVLVGDSVGMVLHGLPS
TLGVTMEMMILHGQAVARGLKQAMMVIDMPFASYEESPQQAFRNAARLMAETGAGAVKLE
GGVEMAETIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDAQADAVLADAHAVAEAGA
FSVVLEKVPQGLADRITAEVAIPTIGIGASVGCDGQILVVDDMLGFFTAFKPKFVKRYAD
LGPLAEAAISEYAAEVRARSFPAPEHVFADQAPAAAKTAAPKAPQKD