Protein Info for Psest_3211 in Pseudomonas stutzeri RCH2

Annotation: Glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF00255: GSHPx" amino acids 11 to 110 (100 residues), 121.1 bits, see alignment E=7.8e-40

Best Hits

Swiss-Prot: 54% identical to GPX2_SYNY3: Hydroperoxy fatty acid reductase gpx2 (gpx2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 95% identity to psa:PST_1129)

MetaCyc: 54% identical to hydroperoxy fatty acid reductase 2 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNV8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Psest_3211 Glutathione peroxidase (Pseudomonas stutzeri RCH2)
MSAFHQLVLPGLGGEELPMAQFGDQITLVVNVASQCGLTPQYAGLERLQQQYASRGFSVL
GVPCNQFAAQEPGSDEEIRSFCSLNYGVTFPLSGKLEVNGPQRHPLYRLLAGEGADFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPALIHAIESALA