Protein Info for PGA1_c32030 in Phaeobacter inhibens DSM 17395

Annotation: glycerol kinase GlpK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR01311: glycerol kinase" amino acids 3 to 491 (489 residues), 686.7 bits, see alignment E=7e-211 PF00370: FGGY_N" amino acids 3 to 249 (247 residues), 263.2 bits, see alignment E=2.4e-82 PF02782: FGGY_C" amino acids 259 to 447 (189 residues), 133.5 bits, see alignment E=9e-43

Best Hits

Swiss-Prot: 77% identical to GLPK_RUEPO: Glycerol kinase (glpK) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 82% identity to sit:TM1040_3440)

MetaCyc: 53% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F389 at UniProt or InterPro

Protein Sequence (494 amino acids)

>PGA1_c32030 glycerol kinase GlpK (Phaeobacter inhibens DSM 17395)
MTYILAIDQGTTSTRAILFDDRMQAQGSAQQEFTQHFPQAGWVEHDPENLWSTTLDVCRK
VMAEQGVTAAEIAGIGITNQRETTVVWDRHSGKPIHNAIVWQDRRTSPICEELRAAGHED
SVRQKTGLLLDPYFSGTKLKWILDTVPEARARAEAGDLLFGTVDSFLIWRLTGGASHVTD
ATNAARTLMYDIRKGRWSSEICGFLGVPRDMLPEVKDCAADFGTTKAEFLGGEIAILGVA
GDQQAATIGQACFQPGMMKSTYGTGCFALLNTGDTPVVSQNRMLTTIAYQLDGAPTYALE
GSIFIAGAAVQWLRDGLGIIGSAQESGALARNADPGQDVILVPAFTGLGAPYWKPDCRGG
MFGLTRNSGPAEFARAALQSVAYQTRDLWEAMRADWDGESLVTLRVDGGMSASNWTMQSL
ADLLGAAVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAATWALDQQFTPEMDEDRRSAA
YARWKRAVEAVIGV