Protein Info for PGA1_c32020 in Phaeobacter inhibens DSM 17395

Annotation: 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01494: FAD_binding_3" amino acids 2 to 166 (165 residues), 41.4 bits, see alignment E=5.7e-15 amino acids 287 to 349 (63 residues), 28.6 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 40% identical to PHZS_PSEAE: 5-methylphenazine-1-carboxylate 1-monooxygenase (phzS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 78% identity to sil:SPO0105)

MetaCyc: 40% identical to 5-methylphenazine-1-carboxylate 1-monooxygenase (Pseudomonas aeruginosa)
RXN-11898 [EC: 1.14.13.218]; 1.14.13.218 [EC: 1.14.13.218]

Predicted SEED Role

"monooxygenase family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.218

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4Y0 at UniProt or InterPro

Protein Sequence (418 amino acids)

>PGA1_c32020 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases (Phaeobacter inhibens DSM 17395)
MTVMIAGAGIAGLTLGLTLHELGVPFHIYEATETLKPMGVGINLQPNAVRELFDLGLEAE
LSAIGVRTRQLGFYSKLGKTIWEEPRGEAAGYSWPQFSVHRGALQMMLYHALLARAGSGV
ITTGARATGFDTSDQGACLHLENGRTARGDLLIAADGIHSAIRAQMYPDEGAPIWNGRIL
WRATTFAPAFHGGAAMAMIGHDQLRLVAYPISAPDDTGTATINWIAEKQFDPSAHWNRES
WNRAADIRDFLPDFANWQFDWIDVPALINGAEIVYEYPMVDRDPLPRWQDGPVSLMGDAA
HPTYPVGSNGASQAIVDARLIGAQMLAHGVTPQALSTYEAAVRPVTTAVALANRAGGGPD
GVLQQVETLCGGDFSVIDDVIPQDELAAHAAKYKSIAGFSIEELNARPRTIPAGTRIN