Protein Info for PGA1_c31980 in Phaeobacter inhibens DSM 17395

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF23441: SDR" amino acids 2 to 250 (249 residues), 42.5 bits, see alignment E=1.1e-14 PF00106: adh_short" amino acids 6 to 197 (192 residues), 183.3 bits, see alignment E=7.3e-58 PF08659: KR" amino acids 9 to 163 (155 residues), 36.8 bits, see alignment E=8e-13 PF13561: adh_short_C2" amino acids 14 to 250 (237 residues), 212.6 bits, see alignment E=1.3e-66

Best Hits

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 76% identity to rde:RD1_0098)

Predicted SEED Role

"toluenesulfonate zinc-independent alcohol dehydrogenase" in subsystem Toluene degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F385 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PGA1_c31980 short chain dehydrogenase (Phaeobacter inhibens DSM 17395)
MRLAGKCAIVTGGASGFGAGIVTKFLTEGARVMIADINADAAAAAASDVCETYGPDRAIA
QTVDVSDRASVDQMAQAALNHFGQIDILVNNAGVSHLPTPLEDVSEEDFDRVVAVNMKSV
YLTARALVPHMKSRQSGAILNVASTAGVSPRPNLNWYNASKGWMITATRTMAVELAPAGV
RVNAINPVAGETPLLKTFMGEDTPEVRAKFLSTIPIGRFSTPEDMGNAACYLCSDEASMV
TGVALEVDGGRCI