Protein Info for HP15_3085 in Marinobacter adhaerens HP15
Annotation: ferric-uptake regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to FUR_PSEAE: Ferric uptake regulation protein (fur) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 96% identity to maq:Maqu_3365)Predicted SEED Role
"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PPH8 at UniProt or InterPro
Protein Sequence (136 amino acids)
>HP15_3085 ferric-uptake regulator (Marinobacter adhaerens HP15) MSSENAELRKVGLKVTLPRVKIFNILETAEEHHLSAEDVYKKLLEQGDDVGLATVYRVLT QFEAAGLVLRHNFEGGHAVFEMAGDDHHDHMVCTQTGEVVEFVDEVIEERQKKIAEEHGY EIVDHSLILYVKPIKS