Protein Info for Psest_3200 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF04336: ACP_PD" amino acids 1 to 182 (182 residues), 228.2 bits, see alignment E=4.2e-72

Best Hits

Swiss-Prot: 36% identical to ACPH_SALPK: Acyl carrier protein phosphodiesterase (acpH) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: None (inferred from 87% identity to psa:PST_1140)

Predicted SEED Role

"Acyl carrier protein phosphodiesterase (EC 3.1.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 3.1.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQM2 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Psest_3200 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MNYLAHLHLGGPGPEDMLGSLYGDFVKGSLQGRWPARIEAGIRLHRQIDAYTDSHPLVLE
AKARFPSERRRYAGILLDLFFDHCLAANWSDYSSEPLELFTQRAYRALTEEPQLPGKLAV
IAPHMAAHDWLGSYREFDVLERVLANMSRRLSRPDGLAGGLEELEQLYDPLLEDFRLFYP
QLQQFAKAAM