Protein Info for HP15_3080 in Marinobacter adhaerens HP15

Annotation: chaperone protein dnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 97.3 bits, see alignment E=6.6e-32 TIGR02349: chaperone protein DnaJ" amino acids 5 to 345 (341 residues), 460.7 bits, see alignment E=2.1e-142 PF01556: DnaJ_C" amino acids 116 to 329 (214 residues), 175.6 bits, see alignment E=1.1e-55 PF00684: DnaJ_CXXCXGXG" amino acids 143 to 203 (61 residues), 62.2 bits, see alignment E=6.8e-21

Best Hits

Swiss-Prot: 93% identical to DNAJ_MARHV: Chaperone protein DnaJ (dnaJ) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 93% identity to maq:Maqu_3361)

MetaCyc: 66% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPH3 at UniProt or InterPro

Protein Sequence (375 amino acids)

>HP15_3080 chaperone protein dnaJ (Marinobacter adhaerens HP15)
MAKRDYYEILGISRDADEKEIKRAYRKLAMKYHPDRNPDDTEAENKFKEASEAYEVLAEP
SKRAAYDQFGHAGVDGQAGGGGFGGGGASFSDIFGDVFGDIFGGGGRGRNTRGADLRYTL
ELDLEEAVKGKTVQIKIPGHRECEVCDGSGAEKGSRPETCSTCKGMGQVRMQQGFFTVQQ
ACPTCRGSGQIIKNPCKACHGQGRVQEEKTLSVKVPPGVDTGDRIRLSGEGEMGVDGGPP
GDLYVQIAVREHSIFTRDGRNLYCEVPISIVDASLGGELEVPTLDGRVKLKIPPETQTGK
LFRLRNKGVSPVRGGPAGDLLCRVIVETPVNLTKRQKELLEEFQKTLDASNGTEHGPKKT
SWFEGVKSFFDEMKF