Protein Info for HP15_3079 in Marinobacter adhaerens HP15

Annotation: dihydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 1 to 264 (264 residues), 342.1 bits, see alignment E=1.2e-106 PF01113: DapB_N" amino acids 1 to 124 (124 residues), 138.3 bits, see alignment E=1.5e-44 PF05173: DapB_C" amino acids 127 to 263 (137 residues), 170.6 bits, see alignment E=1.6e-54

Best Hits

Swiss-Prot: 69% identical to DAPB_HAHCH: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 94% identity to maq:Maqu_3360)

MetaCyc: 63% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPH2 at UniProt or InterPro

Protein Sequence (266 amino acids)

>HP15_3079 dihydrodipicolinate reductase (Marinobacter adhaerens HP15)
MRVAIIGAAGRMGKVLIEAVDGTEGLELGAAVVEPGSSLIGADAGEMTGIGKTGVKMAGS
LADVKDDFDVLVDFTFPDLTLENAEFCKANGKMLVIGTTGMSDAEKQQLALAAESTAVVF
APNMSVGVNVVLNLLRTAAATLGDDYDVEIIEAHHRHKKDAPSGTALRMGEVVADALGRD
LKECAVYGREGFTGERTRKEIGFETIRAGDVVGDHTVLFATEGERIEVTHKASSRMTFAK
GAMRAALWLKDKPAGLYDMQDVLDLK