Protein Info for HP15_3076 in Marinobacter adhaerens HP15

Annotation: protein containing prokaryotic transcription elongation factor GreA domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR01462: transcription elongation factor GreA" amino acids 1 to 151 (151 residues), 186.2 bits, see alignment E=1.9e-59 PF03449: GreA_GreB_N" amino acids 1 to 69 (69 residues), 98.9 bits, see alignment E=1.6e-32 PF01272: GreA_GreB" amino acids 78 to 152 (75 residues), 94.2 bits, see alignment E=3.7e-31

Best Hits

Swiss-Prot: 69% identical to GREA_THISH: Transcription elongation factor GreA (greA) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 90% identity to maq:Maqu_3357)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPG9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>HP15_3076 protein containing prokaryotic transcription elongation factor GreA domain (Marinobacter adhaerens HP15)
MTKAGETRLREELQKLKSEDRPRVIAAIADAREHGDLKENAEYHAAREQQSFIEGRIQEI
EGKLSAAQVIDVTTIENTGKVIFGTTVHLLNMDTDEQVIYKIVGEDEADIKAGKLSISSP
IARALVGKSEGDVVAIRVPSGTVEYEIEQVEYI