Protein Info for HP15_3073 in Marinobacter adhaerens HP15

Annotation: dihydropteroate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01496: dihydropteroate synthase
  • amino acids 17 to 271 (255 residues), 324.9 bits, E=2.1e-101
• PF00809: Pterin_bind
  • amino acids 18 to 257 (240 residues), 291.3 bits, E=3.3e-91

Best Hits

Swiss-Prot: 58% identical to DHPS_ECOL6: Dihydropteroate synthase (folP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 86% identity to maq:Maqu_3354)

MetaCyc: 58% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• tetrahydrofolate biosynthesis II (2/3 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

See E4PP07 at UniProt or InterPro

Protein Sequence (276 amino acids)

>HP15_3073 dihydropteroate synthase (Marinobacter adhaerens HP15)
MKMNFAGRELDMSRCHVMGVLNVTPDSFSDGGQFNRPDAALVRARQMVADGATFIDIGGE
STRPGATPVSLQEELDRVCPVVEAAARELDAVISVDTSAPEVMAETAKLGAGLINDVRAL
QRDGAPEVAAKAGIPVCIMHIQGEPDTMQDRPEYRNVRREVSAFLTERIRVAEHAGIRPE
NILLDPGFGFGKSLEHNLQLLASLEQMHILGHPLLVGVSRKSMLGHITGREVNERLPASL
AAATIAAMKGASIIRVHDVRETVDAIRVVAAVKEAG