Protein Info for HP15_3072 in Marinobacter adhaerens HP15

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 4 to 135 (132 residues), 155.7 bits, E=1.2e-49
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 443 (437 residues), 631.8 bits, E=2.8e-194
• PF02879: PGM_PMM_II
  • amino acids 158 to 255 (98 residues), 66.7 bits, E=4.7e-22
• PF02880: PGM_PMM_III
  • amino acids 259 to 365 (107 residues), 107.2 bits, E=1.1e-34
• PF00408: PGM_PMM_IV
  • amino acids 374 to 442 (69 residues), 64 bits, E=2.2e-21

Best Hits

Swiss-Prot: 88% identical to GLMM_MARHV: Phosphoglucosamine mutase (glmM) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 88% identity to maq:Maqu_3353)

MetaCyc: 59% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• glucosylglycerol biosynthesis (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• peptidoglycan recycling I (8/14 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See E4PP06 at UniProt or InterPro

Protein Sequence (447 amino acids)

>HP15_3072 phosphoglucosamine mutase (Marinobacter adhaerens HP15)
MSERKYFGTDGIRGHVGEFPITPEFMLKLGWAAGQAFKRDGQRNSVLIGKDTRLSGYMFE
SALEAGLAAAGVDVKLLGPMPTPAIAYLTRTFRASAGIVISASHNPHHDNGIKFFSAAGT
KLDDALEAEIERWLDKPIEVCGPTELGKASRVDDAPGRYVEFCKSTVPNEFTLDGMNIVL
DCAHGATYHVAPKVFRELGAKVSVIGGDPDGLNINLNVGSTHLQALKAAVIEKNADLGIA
FDGDGDRVLMVDRDGSEVDGDELLYVIASQRFAEDRLKGGVVGTLMTNLGVELALNEIGI
EFERAKVGDRYVMERLLANNWVLGGEGSGHMVIRDCTSTGDGIVSALQVLLSVWKSGKTL
ADLRKGMSKLPQKMINVRVAQRFDPFSRDDIVAAVRKAETELGSSGRILLRASGTEPLIR
VMAEGQDASEILRVVEELAKVVEKSTA