Protein Info for Psest_0314 in Pseudomonas stutzeri RCH2

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF05221: AdoHcyase" amino acids 12 to 149 (138 residues), 242.4 bits, see alignment E=9.4e-76 amino acids 149 to 467 (319 residues), 173.2 bits, see alignment E=1.1e-54 TIGR00936: adenosylhomocysteinase" amino acids 13 to 460 (448 residues), 508 bits, see alignment E=9.3e-157 PF00670: AdoHcyase_NAD" amino acids 199 to 380 (182 residues), 188 bits, see alignment E=2e-59

Best Hits

Swiss-Prot: 98% identical to SAHH_PSEU5: Adenosylhomocysteinase (ahcY) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 98% identity to psa:PST_3935)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHN4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Psest_0314 adenosylhomocysteinase (Pseudomonas stutzeri RCH2)
MSAVMTPAGFTDFKVADISLAAWGRREIIIAESEMPALMGLRSKYAAEQPLKGAKILGCI
HMTIQTAVLIETLIALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCI
EQTILKDGQPWDANMVLDDGGDLTQILHDKYPQVLERVHGVTEETTTGVHRLLDMLKGGT
LKIPAINVNDSVTKSKNDNKYGCRHSLNDAIKRATDHLLSGKQALVVGYGDVGKGSAQSL
RQEGMIVKVSEVDPICAMQACMDGFELVSPYKDGINDGTEASVDAALLGKIDLIVTTTGN
VNVCDAGMLKALKKRAVVCNIGHFDNEIDTAFMRANWGWEEVKPQVHKIHRTGKTVDPTN
DDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLYNEKFADLPVAEKSKNVTVM
VLPKKLDEEVALEMVKGFGGVVTQLTAKQAEYIGVTVEGPFKPDSYRY