Protein Info for PGA1_c31750 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00005: ABC_tran" amino acids 27 to 169 (143 residues), 108.3 bits, see alignment E=5e-35

Best Hits

KEGG orthology group: None (inferred from 86% identity to sit:TM1040_2760)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0T5 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PGA1_c31750 ABC transporter, ATP-binding protein (Phaeobacter inhibens DSM 17395)
MTEDAIRIEGLQKTYKGRRGQPAKDALKGVDLSIPRGSVFGLLGPNGAGKSTMINILAGL
VLKTAGKVTIWGFDQDENPRQSRASIGVMPQELNLDPFFSPRGALEVQAGLYGVPKAERR
SDDILRMVGLEDKAHAYARTLSGGMQRRLLLGKALVHHPNILVLDEPTAGVDIELRQMLW
ENIRKLNAQGMTIILTTHYLEEAEEMCDEIAIINQGELVARDTTANLLGRLDAKAMVVHP
AHPVTALPVGDGIASELRGDGVVILRYHGNRTRAEEVLSAVREAGISIRDVKTEEADLED
VFLALTKSRS