Protein Info for Psest_3178 in Pseudomonas stutzeri RCH2

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00655: formyltetrahydrofolate deformylase" amino acids 5 to 282 (278 residues), 364.4 bits, see alignment E=2.3e-113 PF00551: Formyl_trans_N" amino acids 87 to 262 (176 residues), 144.3 bits, see alignment E=1.8e-46

Best Hits

Swiss-Prot: 46% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 98% identity to psa:PST_1165)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLQ0 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Psest_3178 formyltetrahydrofolate deformylase (Pseudomonas stutzeri RCH2)
MRTFRLVIACPDGVGIVAKVSNFLATYNGWITEANHHSDHQSGWFFMRHEIRADSLPFDL
EGFRQAFAPIAREFSMEWRITDSEQRKRVVLMASRESHCLADLLHRWHSGELDCDIPCVI
SNHDDLRSMVEWHGIPYIHVPVDPANKQEAFAEVTRLVREQRADVIVLARYMQILPSELC
DEFAQRVINIHHSFLPSFVGAKPYHQASLRGVKLIGATCHYVTEELDAGPIIEQDVVRVS
HRDSIEDMVRLGKDVEKMVLSRGLRYHLEDRVLVHSNKTMVFN