Protein Info for HP15_3062 in Marinobacter adhaerens HP15

Annotation: lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF12146: Hydrolase_4" amino acids 39 to 154 (116 residues), 48 bits, see alignment E=2.7e-16 PF00561: Abhydrolase_1" amino acids 43 to 150 (108 residues), 42.4 bits, see alignment E=1.7e-14 PF12697: Abhydrolase_6" amino acids 44 to 176 (133 residues), 36.1 bits, see alignment E=2.8e-12 PF00326: Peptidase_S9" amino acids 59 to 221 (163 residues), 26.9 bits, see alignment E=8.2e-10

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 80% identity to maq:Maqu_3343)

Predicted SEED Role

"Hydrolase of the alpha/beta superfamily in cluster with COG2110"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNZ6 at UniProt or InterPro

Protein Sequence (253 amino acids)

>HP15_3062 lipoprotein (Marinobacter adhaerens HP15)
MTYITPDRLNLEYEDIYLDTADGETLHGWWLPAEAPENNARGTVYFLHGNAQNVSSHILN
VAWLPEKGYNVFTIDYRGYGKSTGDPDIEGALHDVETGLRWLAQKPDVTDRPLYILGQSL
GGGLGIALASEWIQREEQPRLDGVILDGTFSGFRKIAREKLGGFWLTWPLQIPLSWTIPD
DYEGLDHIPRISPVPVMVIHSVRDGIIPFHHGEALFEAAQEPKEFLQTDTPHGATFVIPG
YRREVLRFMNAGR