Protein Info for HP15_3057 in Marinobacter adhaerens HP15

Annotation: leucine/isoleucine/valine transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 197 to 213 (17 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 351 to 379 (29 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details PF11862: DUF3382" amino acids 5 to 107 (103 residues), 68.4 bits, see alignment E=5.6e-23 PF02653: BPD_transp_2" amino acids 116 to 402 (287 residues), 187.3 bits, see alignment E=3.1e-59

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 93% identity to maq:Maqu_3337)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNZ1 at UniProt or InterPro

Protein Sequence (423 amino acids)

>HP15_3057 leucine/isoleucine/valine transporter permease subunit (Marinobacter adhaerens HP15)
MAANNFRHALFCAFITLIISYPIIGFNLEAQGINVTLTGADASTIVMVLFAAVIVFLFQM
FREQIMGGLKSIPHPLPQSNKEPMAENRRAKIESWVLTGIVVLALFWPFFVSRGAVDLAT
LVLIYIMLALGLNVVVGLAGLLDLGYVAFYAVGAYTFALLSQYTGISFWLALPIGALLAA
LFGLVLGFPVLRLRGDYLAIVTLGFGEIIRILLNNWTTLTGGPNGIGGIPDPTLFGMEFG
RRVKEEGNTSFHETFGIAYSGEHKVIFLYLIALVLAVFTALVIRRFMRMPVGRAWEALRE
DEIAARSLGLSRTAVKLSAFTIGAFFAGFAGTVFASKQGFISPESFVFLESAIILAIVVL
GGMGSQIGVVLAAIAVTILPELAREFSEYRMLIFGAAMVLMMVWRPQGLMPMRRIHIELK
RQE