Protein Info for Psest_3171 in Pseudomonas stutzeri RCH2

Annotation: Predicted ATPase related to phosphate starvation-inducible protein PhoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF13638: PIN_4" amino acids 15 to 159 (145 residues), 121.2 bits, see alignment E=3.7e-39 PF02562: PhoH" amino acids 253 to 446 (194 residues), 141.9 bits, see alignment E=1.9e-45

Best Hits

KEGG orthology group: K07175, PhoH-like ATPase (inferred from 97% identity to psa:PST_1172)

Predicted SEED Role

"Predicted ATPase related to phosphate starvation-inducible protein PhoH" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNT0 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Psest_3171 Predicted ATPase related to phosphate starvation-inducible protein PhoH (Pseudomonas stutzeri RCH2)
MDDYGRPRATQPTLYVLDTNVLIHDPNALLNFQEHQVAIPMTVLEELDQLKTGKHSVAAE
CRQAIRLIDKLLGDATPEEVELGVPIQRGKSGPSGSLSILMSKRGEPNALPEDLNDNKII
NQVVELSKQRPGVPVVLVTKDINMRLKARACGVAAEDYHTDQLIDDVGQLSPGYHSVTGS
FWDRVSKVETHQGHGRTWHRVQLTDNLPAVHINEFIIDEQGFVGWIKGIKADELLLLDLH
QEPLLHQEAWGLRPRDIHQALALFALLDPDIHLVNLSGAAGSGKTILALAAAIEQTVVSK
RYRRIIATRSVQGLDEDIGFLPGTEAEKMEPWLGAITDNLEALHMEDENTHGSIDYILQK
VPLQFKSLNYIRGRSFQQSLILIDECQNLTPHQMKTIITRAGNGSKVVCLGNLAQIDTPY
LSATSSGLTYLTERFKDFSHGVHITLQGVPRSVLAEYAEAHM