Protein Info for PGA1_c31630 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 8 to 32 (25 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00892: EamA" amino acids 11 to 144 (134 residues), 65.9 bits, see alignment E=2.1e-22

Best Hits

KEGG orthology group: None (inferred from 45% identity to sil:SPO3643)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F358 at UniProt or InterPro

Protein Sequence (321 amino acids)

>PGA1_c31630 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MTQQQASLPILGVIAAVGAAVCFSIIDVIFKFLSGDYPLYQVVMLRSVVAMVVLLALIIP
LEGGYGILRTRQPRLHLLRSLAVLFANLCFFTGLAIMPMAEAVAIAFATPLVVTSLSVLF
LKERVGPWRWMAVAIGFTGILIIMRPGPGTFQPAAILPFLGACGYATLHVLTRRAGGADK
AATLSFYPTLGFLLVSTLVGLTTGDGRFAGSDNAGLQFILRAWIWPEPQDWILFLTVGLA
GSIGGYLVSQAYRQCEAGLVAPFEYIAMPMAVIWGILVFDEWPDAPVWIGSTLIIGAGLV
SVWRETRRSRPAPRPRPRSTG