Protein Info for Psest_3170 in Pseudomonas stutzeri RCH2

Annotation: molybdenum cofactor biosynthesis protein MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00581: molybdenum cofactor biosynthesis protein C
  • amino acids 2 to 149 (148 residues), 222 bits, E=1.3e-70
• PF01967: MoaC
  • amino acids 13 to 147 (135 residues), 195.3 bits, E=2.1e-62

Best Hits

Swiss-Prot: 97% identical to MOAC_PSEU5: Cyclic pyranopterin monophosphate synthase (moaC) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 97% identity to psa:PST_1173)

MetaCyc: 65% identical to cyclic pyranopterin monophosphate synthase (Escherichia coli K-12 substr. MG1655)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

See L0GQJ3 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Psest_3170 molybdenum cofactor biosynthesis protein MoaC (Pseudomonas stutzeri RCH2)
MLTHLDSQGRASMVDVTDKAVTAREAVAEARVRMLPQTLQMIQQGGHPKGDVFAVARIAG
IQAAKKTYELIPLCHPLLLTSIKVELQADGEDCVLIRATCKLAGQTGVEMEALTAASVAA
LTIYDMCKAVDRGMVIEGVRLLEKLGGKSGHWQVQA