Protein Info for Psest_3168 in Pseudomonas stutzeri RCH2

Annotation: Molybdopterin converting factor, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02391: MoaE" amino acids 6 to 119 (114 residues), 120 bits, see alignment E=3e-39

Best Hits

Swiss-Prot: 80% identical to MOAE_PSEAE: Molybdopterin synthase catalytic subunit (moaE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 92% identity to psa:PST_1175)

MetaCyc: 64% identical to molybdopterin synthase catalytic subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLP0 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psest_3168 Molybdopterin converting factor, large subunit (Pseudomonas stutzeri RCH2)
MTVRVQTAAFDPGAELNALHAANLGIGAVAGFVGYVRDFNDGEDVAGMLLEHAPGMTEKA
LEKIVVEAEQRWPLLRLDVLHRVGPLEPGEPIVFVGAASAHRDAAFDACRFVMDYLKTRA
PFWKKESTPSGPRWVEGRASDQLAAERWDGKR