Protein Info for Psest_0311 in Pseudomonas stutzeri RCH2

Annotation: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 9 to 462 (454 residues), 491.3 bits, see alignment E=1.5e-151 PF02321: OEP" amino acids 63 to 252 (190 residues), 90.6 bits, see alignment E=5.7e-30 amino acids 281 to 460 (180 residues), 102.5 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 70% identical to OPRM_PSEAE: Outer membrane protein OprM (oprM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 93% identity to psa:PST_3938)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGN4 at UniProt or InterPro

Protein Sequence (474 amino acids)

>Psest_0311 efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family (Pseudomonas stutzeri RCH2)
MNKSLLALALAAALGGCSLIPEYQRPDAPVAGDWPQGEAYPQGAAQASERALGWREFFRD
PALQQLIEVALENNRDLRVAALNVDAYRALYRVQRADVLPAVSADGSGTRSRTPGDMNMT
GEPAISSQYSATFGVSWELDLFGRLRSLRDQALEEYFASEAAQRSTQISLIASVANAWLT
LQADQALLQVTRDTLKTYEESLGLTQRSFDVGVASALELRQARSAVDSARVSIEQYTRLV
AQDRNALTLLLGQSLPAGLPSGDGLERTQLAALPIGLPSDLLQQRPDILQAEYQLRAVNA
SIGAARAAFFPRISLTGAAGTASSELSGLFDGGSGYWSFSPSISVPIFNAGQLRANLDYA
QISKNIQVAQYEKAIQTAFREVADGLAAQATYTRQVQAQRDLLQTSEDYYNLAERRYRTG
VDSYLTVLDAQRQLFNVQQQLIGDRLAQMTSEVNLFKALGGGWQEAGQTQPSGG