Protein Info for PGA1_c03220 in Phaeobacter inhibens DSM 17395

Annotation: branched-chain amino acid transport protein azlC-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details PF03591: AzlC" amino acids 19 to 163 (145 residues), 121.9 bits, see alignment E=1.4e-39

Best Hits

KEGG orthology group: None (inferred from 76% identity to sit:TM1040_3757)

Predicted SEED Role

"AzlC family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW68 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PGA1_c03220 branched-chain amino acid transport protein azlC-like protein (Phaeobacter inhibens DSM 17395)
MAITTTKSAFWKGFRDGAPFLLVSGPFGLLFGVLAAEAGLIVPEAMIFSLSVFAGSAQFT
ALQLMEENTPLVIILISALAVNLRVAMYSASLTPYLGGAPLWQRACAAYLTVDQSYALSI
VQFETHPQMTLSQRMAYFFGTNGCVAPGWMVATYIGALVGTQIPASWGLDFVLPLAFLAM
IGPMLRTPAHVVACFAAVVTALPATALPYNLGLIVAGLVGMMAGAQAEVWLERRQIAKDP
S