Protein Info for Psest_0031 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 81 to 100 (20 residues), see Phobius details PF19029: DUF883_C" amino acids 73 to 102 (30 residues), 30.3 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_0029)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH49 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Psest_0031 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MSRFSKSTTREEVQHEIDSLMRALDELKHDAARDSRKRLSALRSRAESLWHDQDWDEHYA
DLSKRTREASRAARDCAKEHPLGTLALAAGAFAVIGYLISRR