Protein Info for HP15_3040 in Marinobacter adhaerens HP15

Updated annotation (from data): Arginine N-succinyltransferase (EC 2.3.1.109)
Rationale: Specifically important for utilizing L-Arginine. Automated validation from mutant phenotype: the predicted function (2.3.1.109) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: arginine N-succinyltransferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF04958: AstA" amino acids 1 to 340 (340 residues), 431.7 bits, see alignment E=7e-134 TIGR03243: arginine and ornithine succinyltransferase subunits" amino acids 3 to 342 (340 residues), 426.7 bits, see alignment E=5.4e-132 TIGR03244: arginine N-succinyltransferase" amino acids 3 to 341 (339 residues), 442.6 bits, see alignment E=7.3e-137

Best Hits

KEGG orthology group: K00673, arginine N-succinyltransferase [EC: 2.3.1.109] (inferred from 79% identity to maq:Maqu_3317)

Predicted SEED Role

"Arginine N-succinyltransferase (EC 2.3.1.109)" in subsystem Arginine and Ornithine Degradation (EC 2.3.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.109

Use Curated BLAST to search for 2.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNX4 at UniProt or InterPro

Protein Sequence (366 amino acids)

>HP15_3040 Arginine N-succinyltransferase (EC 2.3.1.109) (Marinobacter adhaerens HP15)
MLVIRPLQENDLDDLYAMAQSAGKGLTTLPADRELLQKKINHARETFNQRIAPEAGLYLF
ALEDTERKKTVGISGIQARVGLDEVFYNYRLSVTVNASKELGVHVRTPTLHLSNDMTDTS
EICSLLLSDEYKGGGSGLLLSRCRFMYLDEFRKHFSEKIFAEMRGVSDANGRSPLWDALG
TKFFDMEFSEADMLSGLGNKSFIAELMPKYPIYLSMLPDSARAVIGRVHDNTAPALRMLQ
SEGFNFNGLVDIFDGGPVVEAFVHNVRTVREGMNRHAMVTRKPVNLDVPSEERVMVSNRS
FRDFRVTTVPIDCIGPDTVSLPPEVAEALQIESGDPVRLAPLKDSGLLTKHSYRSSVPGG
ASKWQS