Protein Info for HP15_3034 in Marinobacter adhaerens HP15

Annotation: succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR03242: succinylglutamate desuccinylase" amino acids 34 to 340 (307 residues), 313.7 bits, see alignment E=7.7e-98 PF24827: AstE_AspA_cat" amino acids 61 to 252 (192 residues), 147.6 bits, see alignment E=3.3e-47 PF04952: AstE_AspA_hybrid" amino acids 269 to 342 (74 residues), 85.3 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 39% identical to ASTE_SHEPW: Succinylglutamate desuccinylase (astE) from Shewanella piezotolerans (strain WP3 / JCM 13877)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 75% identity to maq:Maqu_3311)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW8 at UniProt or InterPro

Protein Sequence (351 amino acids)

>HP15_3034 succinylglutamate desuccinylase (Marinobacter adhaerens HP15)
MTVSSDLFGSSHDWLSHTLDNADASLPETKAFLPDGTRISRKAVGVLDIVPPAARSNPNA
EAIIVSAGVHGNETAPIEVLNRLVSELIEGEWELACPVLLIMGNPPAMVAGKRFLEVNLN
RLFDGAHSRNEYEGLAEAARAQELEEACRQFAMANPQALYHYDLHTAIRPSHRERFALYP
FVEGRTVPVDQCDFLLEAEVETLLLQHKAGTTFSSFSSSLLKAESFTVELGKVRPFGQND
LGRFSGIRDALRRRFKGQPSPAPQPPFDHLTVFEVVHEILNTGKNFRFHIPDDVANFTEY
QPGTVIWEDDETSYRVGHSPEAIVFPNPEVPVGHRVGLMIRPETGSDESFI