Protein Info for PGA1_c31400 in Phaeobacter inhibens DSM 17395

Annotation: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase HpcH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF03328: HpcH_HpaI" amino acids 18 to 243 (226 residues), 182.8 bits, see alignment E=2.9e-58

Best Hits

Swiss-Prot: 52% identical to HPCH_ECOHS: 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase (hpcH) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 81% identity to sil:SPO3686)

MetaCyc: 52% identical to 4-hydroxy-2-ketopimelate aldolase monomer (Escherichia coli C)
4-HYDROXY-2-KETOPIMELATE-LYSIS-RXN [EC: 4.1.2.52]

Predicted SEED Role

"2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)" (EC 4.1.2.n4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.-, 4.1.2.n4

Use Curated BLAST to search for 4.1.2.- or 4.1.2.52 or 4.1.2.n4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0R1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PGA1_c31400 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase HpcH (Phaeobacter inhibens DSM 17395)
MPAPKNIFKQALANGDRQIGCWMSFGEAAVAEVMGTCGFDWLVIDGEHAPNDIRSIRDQL
MALAASDSHPVVRVPVGETWIIKQVLDAGAQTVLVPIVEDADQARELVRACQYPPHGTRG
VGATAARATLFGTASDYIQTADQQICLLLQVENRKGIENLNEILAVPGVDGIFIGPADLS
TDMGFEGNSAHPEVRAVIADALARIKAAGKAPGILGTSPEATQAYFDMGAQFLAVGIDVM
LLAKSARALATDWTSK