Protein Info for HP15_3032 in Marinobacter adhaerens HP15

Annotation: amino acid ABC transporter, inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 97 (76 residues), 55.5 bits, see alignment E=3.3e-19 PF00528: BPD_transp_1" amino acids 44 to 239 (196 residues), 93 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_3309)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNW6 at UniProt or InterPro

Protein Sequence (247 amino acids)

>HP15_3032 amino acid ABC transporter, inner membrane subunit (Marinobacter adhaerens HP15)
MARQGRPCLPDIPMLDLKGYGPALMDGAIVTIELAFLSLALSVALGLIGASAKLSQSRVA
KGIATTYTTLIRGVPDLVMMLLFYYGGQVAVNMLSDYIWEAYEIDFFFQFDPFISGVVTI
GLIFGAYMTETFRGAFLAVETGQIEAARAYGFTRFHTFRRIMLPQMMRHALPGLGNNWQV
LLKTTALVSIIGLTDMVRVAEEAAKAERMPFHFFIPVAFVYLALTAGSELFIKWLDKRAN
VGVVQGS