Protein Info for HP15_3017 in Marinobacter adhaerens HP15

Annotation: molybdenum-pterin-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR00638: molybdenum-pterin binding domain" amino acids 1 to 68 (68 residues), 83.8 bits, see alignment E=3.3e-28 amino acids 74 to 141 (68 residues), 83.5 bits, see alignment E=4.2e-28 PF03459: TOBE" amino acids 4 to 66 (63 residues), 64.3 bits, see alignment E=9.5e-22 amino acids 76 to 138 (63 residues), 59.2 bits, see alignment E=3.7e-20

Best Hits

KEGG orthology group: K02019, molybdate transport system regulatory protein (inferred from 67% identity to pfl:PFL_3618)

Predicted SEED Role

"Molybdate-binding domain of ModE" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNV1 at UniProt or InterPro

Protein Sequence (142 amino acids)

>HP15_3017 molybdenum-pterin-binding protein (Marinobacter adhaerens HP15)
MKVSARNALNGKVVSIKEGPVNSEAIVELAGGEQLVAVVTSESAKHLGLESGSQVTALIK
APWVMLMTECDDIRLSARNCLKGKVVSVSDGAVNAEVVLELAGGSRLCAIVTRDAVEELG
LESGVDASAVIKASNIILAVPA