Protein Info for Psest_3124 in Pseudomonas stutzeri RCH2

Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR01298: ribonuclease T" amino acids 22 to 220 (199 residues), 364 bits, see alignment E=1e-113 PF00929: RNase_T" amino acids 32 to 206 (175 residues), 68.5 bits, see alignment E=5.4e-23

Best Hits

Swiss-Prot: 82% identical to RNT_PSEPF: Ribonuclease T (rnt) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 98% identity to psa:PST_1200)

MetaCyc: 65% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQF1 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psest_3124 ribonuclease T (Pseudomonas stutzeri RCH2)
MSEDHFEDELEEHLPGRARSPMARRFRGFLPVVIDVECGGFNSATDALLEIAAVTIGMDE
QGLLYPQDTLFYRVEPFAGANIEPAALEFTGIKLDHPLRMAVPESQALTDIFRSVRKAVK
SAGCKRAILVGHNSSFDLGFLNAAIARCEIKRNPFHPFSSFDTATLAGLAYGQTVLAKAC
QAAGIDFDGREAHSARYDTEKTAELFCGIVNRWREMGGWEEFDE