Protein Info for Psest_3121 in Pseudomonas stutzeri RCH2

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00764: Arginosuc_synth
  • amino acids 6 to 167 (162 residues), 222.2 bits, E=4e-70
• TIGR00032: argininosuccinate synthase
  • amino acids 6 to 398 (393 residues), 471.1 bits, E=1.8e-145
• PF20979: Arginosuc_syn_C
  • amino acids 178 to 396 (219 residues), 269.4 bits, E=2.4e-84

Best Hits

Swiss-Prot: 99% identical to ASSY_PSEU5: Argininosuccinate synthase (argG) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 99% identity to psa:PST_1203)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See L0GPA5 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Psest_3121 argininosuccinate synthase (Pseudomonas stutzeri RCH2)
MADVKKVVLAYSGGLDTSVILKWLQDTYNCEVVTFTADLGQGEEVEPARTKAQALGVKEI
YIDDLREEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGAT
GKGNDQVRFELGAYALKPGVKVIAPWREWDLLSREKLMDYAEKHAIPIERHGKKKSPYSM
DANLLHISYEGGVLEDTWTEHEEDMWKWTVSPEAAPDAPTYIELTYRKGDIVAIDGKDMS
PAQVLAELNRIGGENGIGRLDIVENRYVGMKSRGCYETPGGTIMLKAHRAIESITLDREV
AHLKDELMPKYASLIYNGYWWSPERSMLQQMIDASQVNVNGVVRLKLYKGNVIVVGRKSD
DSLFDANIATFEEDGGAYNQADAGGFIKLNALRMRIAAGKGRTQF