Protein Info for HP15_3004 in Marinobacter adhaerens HP15

Annotation: rhodanese domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details PF00581: Rhodanese" amino acids 40 to 130 (91 residues), 63.3 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 43% identical to YIBN_ECOLI: Uncharacterized protein YibN (yibN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_3165)

Predicted SEED Role

"FIG136845: Rhodanese-related sulfurtransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNT8 at UniProt or InterPro

Protein Sequence (138 amino acids)

>HP15_3004 rhodanese domain protein (Marinobacter adhaerens HP15)
MDRLFEFVVNHYILVSLFVAFLVAILILESRRGGAKISAQGAVNLINKDEAVVVDIRDRK
EFGEGRITGSINIPLNSLKSRVGELSKFKDKQIIVADKMGQHSAMAVKQLNAEGFSNVVR
LNGGVADWKASNLPLVKK