Protein Info for Psest_3117 in Pseudomonas stutzeri RCH2

Annotation: electron transport complex, RnfABCDGE type, E subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 36 to 38 (3 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 156 to 170 (15 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details PF02508: Rnf-Nqr" amino acids 8 to 202 (195 residues), 204 bits, see alignment E=9.6e-65 TIGR01948: electron transport complex, RnfABCDGE type, E subunit" amino acids 9 to 211 (203 residues), 269.1 bits, see alignment E=9.6e-85

Best Hits

Swiss-Prot: 75% identical to RNFE_PSEAB: Ion-translocating oxidoreductase complex subunit E (rnfE) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03613, electron transport complex protein RnfE (inferred from 97% identity to psa:PST_1207)

Predicted SEED Role

"Electron transport complex protein RnfE" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ5 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psest_3117 electron transport complex, RnfABCDGE type, E subunit (Pseudomonas stutzeri RCH2)
MSTPSYRELTVNGLWKNNPALVQLLGLCPLLGVSNSAVNALGLGLATMLVLTCSNIGVSL
VRGVVNTAVRLPAFVMIIAALTTCIELLMQAFTYELYQILGIFIPLITTNCVILGRADGF
AAKHNPLIAGFDGVVMGIGFCLVLVVLGGLRELFGTGALFANMHLLFGPIANDWQITLFN
DYKGFLLAILPPGAFIVLGLLIALKNRIDQQLAERARAAQPAAPAASRRVRVTGVIE