Protein Info for Psest_3114 in Pseudomonas stutzeri RCH2

Annotation: electron transport complex, RnfABCDGE type, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 6 to 439 (434 residues), 626.3 bits, see alignment E=1.1e-192 PF13375: RnfC_N" amino acids 7 to 109 (103 residues), 120.2 bits, see alignment E=1.7e-38 PF01512: Complex1_51K" amino acids 133 to 277 (145 residues), 172.8 bits, see alignment E=2.5e-54 PF10531: SLBB" amino acids 291 to 338 (48 residues), 31 bits, see alignment 9.5e-11 PF13183: Fer4_8" amino acids 369 to 424 (56 residues), 34.3 bits, see alignment 1.4e-11 PF13237: Fer4_10" amino acids 370 to 421 (52 residues), 30.3 bits, see alignment 1.7e-10 PF13534: Fer4_17" amino acids 371 to 424 (54 residues), 25.6 bits, see alignment 7.1e-09 PF12800: Fer4_4" amino acids 371 to 383 (13 residues), 14.5 bits, see alignment (E = 1.9e-05) amino acids 409 to 421 (13 residues), 14.7 bits, see alignment (E = 1.7e-05) PF12838: Fer4_7" amino acids 371 to 423 (53 residues), 35.7 bits, see alignment 4.7e-12 PF13187: Fer4_9" amino acids 371 to 423 (53 residues), 28.7 bits, see alignment 5.3e-10

Best Hits

Swiss-Prot: 59% identical to RNFC_PSEAE: Ion-translocating oxidoreductase complex subunit C (rnfC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 84% identity to psa:PST_1210)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQE3 at UniProt or InterPro

Protein Sequence (892 amino acids)

>Psest_3114 electron transport complex, RnfABCDGE type, C subunit (Pseudomonas stutzeri RCH2)
MTSLKIWDIHGGIHPPEHKDLSNRTPIQPAPLPQRLILPLAQHLGAPAEPCVTLGERVLK
GQQIAVASGFVSAPLHAPTSGVVSLIGPQPYPHVSGMLANAIVIDSDGEDKWIELQPQPD
YRELERPALLELIRQAGISGLGGAGFPTAVKLSPPPTQTIRTLIINGTECEPYITADDLL
MREKAAQLVAGIEILAHLIQPQEVLIGIEDNKPEAIAAVRAAIGERPFVLKVFPTKYPSG
GEKQLIQILTGEEVPSGGLPADIGMLCQNVGTCVAIHDAVLLGKPLISRITTLTGEALAR
PMNVEVLIGTAVDELLAFAGLEQNRLNRLIMGGPMMGFTLPSLEVPVVKTTNCLLASALE
ELPPPPPALPCIRCGECAEACPVSLLPQQLHFFALGQEHEQLKAHHLFDCIECGACAYVC
PSSIPLVQYYRAAKGEIRELEQKQQKAEHSKQRFELRQERLRRAEEQKEAERKARAERAA
RAKAAQSEAGAATITTAAPVQAQKAGLSDAQKKLKIEASMAQVALKKAEKQLAAHDTAEL
QAQVADLRKAAEAAQNALDAAMQESASTASAPATTPVDEEALKKAKIEAAMLKAQIRKLE
KVETPDDDQQAELARLRQQLHEAEQALTAAQDATPAPAAKPADDEALKKAKIEAAMLKAQ
IRKLEKVEAPDDDQQAELARLRQQLHEAEQALAAAQSAAPAPAAKRAADETLKKAKIEAA
MLKAQIRKLEKLESPDDDQQAELARLRQQLHEAEQALAAAQSAAPAPAAKPADDEALKKA
KIELAMKRAELKKAEKAGADEAELSRLRDALAAAEQALHAAEDASQKPAPELVRTSKPGV
DDRQRELKTELAFARADLRKLERDENAEPGAVEAARTRLSEAERQLADYQGS