Protein Info for Psest_3097 in Pseudomonas stutzeri RCH2

Annotation: Positive regulator of sigma E activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 transmembrane" amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details PF04246: RseC_MucC" amino acids 8 to 141 (134 residues), 116.7 bits, see alignment E=3.5e-38

Best Hits

KEGG orthology group: K03803, sigma-E factor negative regulatory protein RseC (inferred from 86% identity to psa:PST_1226)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLH7 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psest_3097 Positive regulator of sigma E activity (Pseudomonas stutzeri RCH2)
MIEEPGRVVALDRGAVWVETRRKSTCSGCSAKSGCGQGLMDSLGVRERRGLIRALSDLHL
QVGDSVIVGIREDALLRGAVLVYLLPLIMLMAAAATAAQFSAREPVVILAGLGGFCVSWL
FVRIRSRHTASDPKLQAVVLRAMLAGPASP