Protein Info for Psest_3092 in Pseudomonas stutzeri RCH2

Annotation: ribonuclease III, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02191: ribonuclease III" amino acids 8 to 220 (213 residues), 235.9 bits, see alignment E=1.9e-74 PF14622: Ribonucleas_3_3" amino acids 18 to 142 (125 residues), 133.8 bits, see alignment E=6.1e-43 PF00636: Ribonuclease_3" amino acids 37 to 127 (91 residues), 92 bits, see alignment E=5.4e-30 PF00035: dsrm" amino acids 155 to 220 (66 residues), 40.6 bits, see alignment E=4.7e-14

Best Hits

Swiss-Prot: 90% identical to RNC_PSEF5: Ribonuclease 3 (rnc) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 98% identity to psa:PST_1231)

MetaCyc: 56% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.3

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLH2 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Psest_3092 ribonuclease III, bacterial (Pseudomonas stutzeri RCH2)
MSTSLARLERRLGYQFKDQELMLLALTHRSYAGRNNERLEFLGDAILNFVAGEALFNHFP
QAREGQLSRLRARLVKGETLAVLARGFELGEYLRLGSGELKSGGYRRESILADTLEALIG
AIYLDAGMDVARERVVAWLANELQGLTLVDTNKDPKTRLQEFLQSRACELPRYEVVDIQG
EPHCRTFFVECQVALLNEKTHGQGASRRIAEQVAAAAALIALGVENGHD