Protein Info for Psest_3084 in Pseudomonas stutzeri RCH2

Annotation: methyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 6 to 246 (241 residues), 295.9 bits, see alignment E=1.2e-92 PF00891: Methyltransf_2" amino acids 55 to 190 (136 residues), 27.4 bits, see alignment E=5.1e-10 PF13847: Methyltransf_31" amino acids 58 to 170 (113 residues), 28.9 bits, see alignment E=2.3e-10 PF13649: Methyltransf_25" amino acids 63 to 163 (101 residues), 51 bits, see alignment E=4.8e-17 PF08242: Methyltransf_12" amino acids 63 to 165 (103 residues), 39.3 bits, see alignment E=2.3e-13 PF08241: Methyltransf_11" amino acids 63 to 166 (104 residues), 43 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 90% identical to CMOA_PSEU5: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 90% identity to psa:PST_1238)

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQC0 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psest_3084 methyltransferase, putative (Pseudomonas stutzeri RCH2)
MTQLPDRIYASPQAQIADFVFNEDVVRVFPDMIKRSVPGYPTIVENIGVIAAQFAQPHTH
LYDLGCSLGAVTQALRRHVKVDNCQVIAVDNSAAMVERCREYLHGQDSMFQELLPVEVIE
GDILALEFRPSSLVALNFTLQFIAPEQRPALLGRIRQALVPGGALLLSEKLRFDDDSEQQ
LLTDLHIAFKRANGYSELEIAQKRSAIENVMKPDSLETHRQRLLDAGFSKVVPWFQCLNF
ASLIALP