Protein Info for Psest_3084 in Pseudomonas stutzeri RCH2

Annotation: methyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00740: tRNA (cmo5U34)-methyltransferase
  • amino acids 6 to 246 (241 residues), 295.9 bits, E=1.2e-92
• PF00891: Methyltransf_2
  • amino acids 55 to 190 (136 residues), 27.4 bits, E=5.1e-10
• PF13847: Methyltransf_31
  • amino acids 57 to 169 (113 residues), 30.3 bits, E=7.9e-11
• PF13649: Methyltransf_25
  • amino acids 63 to 163 (101 residues), 50.6 bits, E=6.7e-17
• PF08241: Methyltransf_11
  • amino acids 63 to 166 (104 residues), 43 bits, E=1.4e-14
• PF08242: Methyltransf_12
  • amino acids 63 to 165 (103 residues), 39.3 bits, E=2.3e-13

Best Hits

Swiss-Prot: 90% identical to CMOA_PSEU5: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 90% identity to psa:PST_1238)

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See L0GQC0 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psest_3084 methyltransferase, putative (Pseudomonas stutzeri RCH2)
MTQLPDRIYASPQAQIADFVFNEDVVRVFPDMIKRSVPGYPTIVENIGVIAAQFAQPHTH
LYDLGCSLGAVTQALRRHVKVDNCQVIAVDNSAAMVERCREYLHGQDSMFQELLPVEVIE
GDILALEFRPSSLVALNFTLQFIAPEQRPALLGRIRQALVPGGALLLSEKLRFDDDSEQQ
LLTDLHIAFKRANGYSELEIAQKRSAIENVMKPDSLETHRQRLLDAGFSKVVPWFQCLNF
ASLIALP