Protein Info for PGA1_c03140 in Phaeobacter inhibens DSM 17395

Annotation: putative tRNA threonylcarbamoyladenosine biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 10 to 209 (200 residues), 182.9 bits, see alignment E=2.2e-58 PF01300: Sua5_yciO_yrdC" amino acids 22 to 198 (177 residues), 189.6 bits, see alignment E=3.5e-60 PF03481: Sua5_C" amino acids 202 to 313 (112 residues), 71.3 bits, see alignment E=1.2e-23

Best Hits

KEGG orthology group: K07566, putative translation factor (inferred from 71% identity to sil:SPO0297)

Predicted SEED Role

"TsaC protein (YrdC-Sua5 domains) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETN1 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PGA1_c03140 putative tRNA threonylcarbamoyladenosine biosynthesis protein (Phaeobacter inhibens DSM 17395)
MSSPTTRLLTAQPQEISTAADLLKEGQLVAFPTETVYGLGADARQTNAVEALYAAKGRPS
FNPLIAHVHSVETAQRHVIWSDIADTLAEAFWPGPLTLVLPLREDHGISPLVTAGLNTLG
IRIPAHPAARALLSVLDGPVAAPSANPSGRISPTTAAHVIAGLGGRIAAVVDDGPCGVGV
ESTIIGLATGTPLLLRPGGLATEEIEAVLGHTLHLRDASDPLTAPGQLLSHYAPRASVRL
NVTTPQDGELYLGFGAMECDLNLSASGDLREAAAQLFGHLHRLDARAQPIAVAPIPDAGL
GVAINDRLRRAAAPR