Protein Info for PGA1_c30680 in Phaeobacter inhibens DSM 17395

Annotation: Predicted metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF01863: YgjP-like" amino acids 39 to 242 (204 residues), 177.6 bits, see alignment E=1.7e-56

Best Hits

KEGG orthology group: K07043, (no description) (inferred from 54% identity to reh:H16_A0007)

Predicted SEED Role

"Putative predicted metal-dependent hydrolase" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4K4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_c30680 Predicted metal-dependent hydrolase (Phaeobacter inhibens DSM 17395)
MPNLPLSPIRTGGRSVRFFDQHLDVDGLSFNIRRSDRRKTLQITVERSGELVILAPPEAT
ESELVEFVQEKLLWVHTKLEEKARLQRRAPVKEFVDGEGFLYLGKSYRLRLVDRQLVDLT
LKNGRFCLRTASVHRGREVFISWYIRKAQAWFEKQTLQHSNRMDVNINEVKVQDLGFRWG
SFGSEGRVSFHWKAALLPPRIAQYIIIHELAHAHHPDHSAKFWIKVEQHLPDWRARKEWL
AENGMQVEGL