Protein Info for Psest_3076 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07715: Plug" amino acids 45 to 147 (103 residues), 74.8 bits, see alignment E=7.6e-25 PF00593: TonB_dep_Rec" amino acids 218 to 640 (423 residues), 144.8 bits, see alignment E=7.5e-46

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 95% identity to psa:PST_1245)

Predicted SEED Role

"Zinc-regulated outer membrane receptor" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP61 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Psest_3076 Outer membrane receptor proteins, mostly Fe transport (Pseudomonas stutzeri RCH2)
MKLKRHPLAWSISLALVPAAWAAEPVELQSVVVSASGLAKQSHEMTTPAAVMEGDELVLR
REATLGETLETVPGVRSSSFGAGAARPVIRGLDGARVKVLSDGVELLDASTISPDHAVTS
EPLLAERIEVLKGPATLLYGGGAIGGVVNVIDKKIPTRVPEKGYEGELELRANSVANEGA
GVFGITAGSGNFAVRAEGTKRQADPYEIPGSSNKQEGSYNDTDSFNLGASFIGERGYIGM
AYGEQNNRYGLLGHEHAECHLDGIQWHCGEHDDEDEDDHDEEGGGVPYVDMRQKRWDLRG
ELSDPLPGFELARLRIGHSDYQHKEIEGGEVGTRFNNDATDARLELTHQPLFGWRGVLGA
QTLRRDFEALGEEAYVPQTLTRNHGLFLLEEYTAGAWRYELGLRHEWQDIDADGRPDTDH
SGTSMSAGAVWTFAPQYSLGFSLTRSQRLPSAEELYANGPHAATRTVELGNVDLEEETSH
NAEITLRKFAGRTTFSLSVFRNEVDDFIYAADTGNDIGGGYREIEYRQQDAVLTGAEGEV
RFQATDATAFTLFGDHVRGKLRDGGGDLPRIPADRLGVRLDQSFTPALNGQLEFYRVQRQ
DELADYESETGGYNMLGASLGYSGSLNQTDYLLYLKANNLLDEKARQHTSFIKDDVLLPG
RNLTVGMRLAF