Protein Info for Psest_3070 in Pseudomonas stutzeri RCH2

Annotation: 3-oxoadipyl-CoA thiolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR02430: 3-oxoadipyl-CoA thiolase" amino acids 3 to 401 (399 residues), 722.8 bits, see alignment E=1.1e-221 PF00108: Thiolase_N" amino acids 5 to 268 (264 residues), 267 bits, see alignment E=2.6e-83 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 7 to 399 (393 residues), 457.9 bits, see alignment E=2.6e-141 PF00109: ketoacyl-synt" amino acids 85 to 123 (39 residues), 24.5 bits, see alignment 2.9e-09 PF02803: Thiolase_C" amino acids 276 to 400 (125 residues), 148.4 bits, see alignment E=1.2e-47

Best Hits

Swiss-Prot: 84% identical to PCAF_PSEAE: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07823, 3-oxoadipyl-CoA thiolase [EC: 2.3.1.174] (inferred from 91% identity to psa:PST_1256)

MetaCyc: 82% identical to subunit of beta-ketoadipyl CoA thiolase (Pseudomonas putida)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]; Acetyl-CoA C-acyltransferase. [EC: 2.3.1.174, 2.3.1.16]

Predicted SEED Role

"Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" in subsystem Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.16

Use Curated BLAST to search for 2.3.1.- or 2.3.1.16 or 2.3.1.174

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNK4 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Psest_3070 3-oxoadipyl-CoA thiolase (Pseudomonas stutzeri RCH2)
MSRDVFICDAVRTPIGRFGGALAAVRADDLAAIPLRALLERNPGLDPAAVDEVFMGSANQ
AGEDNRNVARMALLLAGLPETVPGVTLNRLCASGMDAVGTAFRAISSGELELAIAGGVES
MSRAPYVMGKADTAFGRIQKIEDTTIGWRFINPKMKELYGVDAMPQTADNVADEWQVGRA
DQDAFALRSQQRAAAAQQAGFFAEEIVPVVIRGKKGETVVDTDEHPRADTTAEALAKLKP
VNGPDKTVTAGNASGVNDGAAAMILASAEAVQKYGLKPRAKVLGMASAGVAPRIMGYGPV
PAVRKLCERLNIAVSDFDVIELNEAFAAQGLAVTRDLGVPDDSPKVNPNGGAIALGHPLG
MSGARLVLTAVHQLEKTGGRLGLATMCVGVGQGLALVVERV