Protein Info for Psest_3069 in Pseudomonas stutzeri RCH2

Annotation: 3-oxoadipate enol-lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02427: 3-oxoadipate enol-lactonase
  • amino acids 11 to 261 (251 residues), 326.2 bits, E=6.4e-102
• PF00561: Abhydrolase_1
  • amino acids 22 to 247 (226 residues), 81 bits, E=2.2e-26
• PF12697: Abhydrolase_6
  • amino acids 32 to 252 (221 residues), 54.6 bits, E=5e-18
• PF12146: Hydrolase_4
  • amino acids 36 to 231 (196 residues), 49.7 bits, E=6.6e-17

Best Hits

Swiss-Prot: 45% identical to ELH2_ACIAD: 3-oxoadipate enol-lactonase 2 (catD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 83% identity to psa:PST_1258)

MetaCyc: 69% identical to subunit of 3-oxoadipate enol-lactone hydrolase (Pseudomonas putida)
3-oxoadipate enol-lactonase. [EC: 3.1.1.24]

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• superpathway of salicylate degradation (6/7 steps found)
• aromatic compounds degradation via β-ketoadipate (7/9 steps found)
• 4-methylcatechol degradation (ortho cleavage) (5/7 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (2/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (4/11 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)
• superpathway of aerobic toluene degradation (7/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See L0GQA7 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psest_3069 3-oxoadipate enol-lactonase (Pseudomonas stutzeri RCH2)
MPSVKLADVSLNYRFDGAENAPVLVLSNSLGTDLQMWDDQIAAFAEHFRVLRYDTRGHGG
SGVTPGPYSIEQLGQDVLGMLDAFGIERFAFCGLSMGGLIGQWLGIHAGERLQRLVLCNT
GAKIGTDEVWNTRIDSVLAGREQTMRDMRDASIARWFTADFAQANPAVAARITDMIASTS
PDGYAANCAAVRDADYREQLATIKTPTLIVCGAKDPVTTVEHGEFIQANIPGAELVAFEA
AHLSNVEAGDAFTQRVLTFLRG