Protein Info for HP15_2955 in Marinobacter adhaerens HP15

Annotation: ATP-binding component of ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00005: ABC_tran" amino acids 21 to 163 (143 residues), 119.5 bits, see alignment E=3.5e-38 PF17912: OB_MalK" amino acids 237 to 292 (56 residues), 47.2 bits, see alignment 6.8e-16 PF08402: TOBE_2" amino acids 285 to 361 (77 residues), 21.1 bits, see alignment E=5.7e-08

Best Hits

KEGG orthology group: None (inferred from 61% identity to mme:Marme_4048)

Predicted SEED Role

"Glucose ABC transporter, ATP-binding subunit (EC 3.6.3.-)" (EC 3.6.3.-)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN86 at UniProt or InterPro

Protein Sequence (372 amino acids)

>HP15_2955 ATP-binding component of ABC transporter (Marinobacter adhaerens HP15)
MSQLELRSIRKTYPGVAEETLKGIDIDIASGEFLILVGPSGCGKSTLMNTIAGLETITDG
SIVLDGKDISTMEPKDRDIAMVFQSYALYPTMSVRENIAFGLKIRGLPKHEIDQEVERVA
DLLQISPLMNKKPANLSGGQQQRVAMGRALARRPRIYLFDEPLSNLDAKLRVEMRTEIKK
LHQRLKTTIVYVTHDQIEAMTLADRIAVLKDGELQQLGTPKEVYDRPENLFVAGFMGSPA
MSFVPVTVEQGEGGLQAEVRGNDGRSVKLPVPEFLADRVGKKVILGIRPEHITQPQDQKN
DQTLVAKGEFTIEVTEPTGPDVIALIQLNDTNVHCRIDPEHPVTWGETAELMFDMKKVVF
FDPETEKRIAPH