Protein Info for PGA1_c03130 in Phaeobacter inhibens DSM 17395

Annotation: Putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF02622: DUF179" amino acids 12 to 172 (161 residues), 168.1 bits, see alignment E=7.6e-54

Best Hits

Swiss-Prot: 65% identical to Y296_RUEPO: UPF0301 protein SPO0296 (SPO0296) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K07735, putative transcriptional regulator (inferred from 65% identity to sil:SPO0296)

Predicted SEED Role

"UPF0301 protein YqgE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLM2 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PGA1_c03130 Putative transcriptional regulator (Phaeobacter inhibens DSM 17395)
MDLTGELLIAMPGIGDPRFEHSLILLCSHEDDGAMGLIVNKPAAGVDLSNLLEQLDITPR
SAEEAALPVRFGGPVETQRGFVLHSPEYKSNVSSLRVAEAFSMTATVDVLEDIAMGRGPE
QVMVMLGYAGWGPGQLETEIANNGWLNAPATPELVFDLDDITKWEAALRSLGVDPLTLST
SAGHA