Protein Info for PGA1_c30550 in Phaeobacter inhibens DSM 17395

Annotation: Domain of Unknown Function (DUF1206).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details PF06724: DUF1206" amino acids 41 to 106 (66 residues), 35.1 bits, see alignment E=5.8e-13 amino acids 125 to 188 (64 residues), 33.1 bits, see alignment E=2.5e-12 amino acids 211 to 280 (70 residues), 56.2 bits, see alignment E=1.5e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0G7 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PGA1_c30550 Domain of Unknown Function (DUF1206). (Phaeobacter inhibens DSM 17395)
MSDHLKSGLANRTLPSQQTRDEILDQINPDDFSWAIPIMRAGYGGRALVYLTIAGTSLWS
IWQGGEAKGTTAALEWLDGGWGTIVLLFIILGLAAYALWRVVDSIWDLEAYGRGMKGLVA
RTAMIVTGLIHLIMAGLAVTVLIDHQSEGRSGGGTLTELAASSTGTMLLGAAGLLTLGAA
GYYLHKAWDEGYRVHLRANQLTRRLNTLLKLGVAANGVVIGVIGALILKAAMSASAENPD
GIGSVFDWLQEQVFGQILVTALCLGLLGFALFCWINALYRVVPKASQNGTETLGDALGDN