Protein Info for PGA1_c30520 in Phaeobacter inhibens DSM 17395

Annotation: translocator protein, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details PF01810: LysE" amino acids 24 to 202 (179 residues), 49.1 bits, see alignment E=2.4e-17

Best Hits

KEGG orthology group: None (inferred from 57% identity to sil:SPO3613)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4I9 at UniProt or InterPro

Protein Sequence (205 amino acids)

>PGA1_c30520 translocator protein, LysE family (Phaeobacter inhibens DSM 17395)
MPCIFIAMTYELFLALAAFVFGTVFTPGPNNLMLMASGANFGFRRSLPHLTGVAVGFPLM
ILPVGLGVMQLFDAFPALTWIMTALSVAYMLWLAWKVANAAPPREGEAQGTPLSFLQACA
FQWVNPKAWAMALGAITLYAASRDVTAILWVSGTYLLVGCFSASTWTLLGQQLRRLLTRP
AQLRAFNWTMAALLLASLAAILLQR