Protein Info for PGA1_c30510 in Phaeobacter inhibens DSM 17395

Annotation: putative leucine-responsive regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13404: HTH_AsnC-type" amino acids 4 to 45 (42 residues), 58.5 bits, see alignment E=9.7e-20 PF13412: HTH_24" amino acids 5 to 51 (47 residues), 64.4 bits, see alignment E=1.1e-21 PF12840: HTH_20" amino acids 10 to 51 (42 residues), 27.4 bits, see alignment E=5.5e-10 PF01037: AsnC_trans_reg" amino acids 69 to 149 (81 residues), 73.5 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 41% identical to LRP_ECOLI: Leucine-responsive regulatory protein (lrp) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to sit:TM1040_3163)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQU8 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PGA1_c30510 putative leucine-responsive regulatory protein (Phaeobacter inhibens DSM 17395)
MAKLDQINDRILQELNRDGRISNLELADRVGLSPSACLRRVQELERSGVITGYRAVLNRQ
ALGVGFVTYIGVGLGEHTKEAQEAFEVAMRRAPEVVECHNITGTIEYLLRVECADLPSYK
QFHTDILGTSPYVTSITTYVVMGSPKDMRA